Atlas Antibodies Anti-PLEKHA8 Antibody

상품 한눈에 보기

인간 PLEKHA8 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human 반응성 검증 완료.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA072314-100 Anti-PLEKHA8 Antibody, pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 8 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA072314-25 Anti-PLEKHA8 Antibody, pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 8 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PLEKHA8 Antibody

Anti-PLEKHA8 Antibody

Target: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 8
Supplier: Atlas Antibodies

Recommended Applications

면역세포화학 (ICC)

Product Description

Polyclonal Antibody against Human PLEKHA8

Alternative Gene Names

FAPP2
MGC3358

Open Datasheet

Target Information

항목	내용
Target Protein	pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 8
Target Gene	PLEKHA8
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000005225 (85%), Rat ENSRNOG00000009971 (78%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TSELLYRTPPGSPQLAMLKSSKMKHPIIPIHNSLERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEIDCSISSEENTDDNITVQGEIMK

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand