원본
Atlas Antibodies Anti-PLEKHA3 Antibody
상품 한눈에 보기
Human PLEKHA3 단백질을 인식하는 고품질 폴리클로날 항체. WB, IHC, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG로 정제된 고특이성 항체. PrEST 항원 기반 친화 정제 방식으로 높은 재현성과 신뢰성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034497-100 Anti-PLEKHA3 Antibody, pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034497-25 Anti-PLEKHA3 Antibody, pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PLEKHA3 Antibody
Anti-PLEKHA3 Antibody
Target: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, independent validation)
- ICC (Immunocytochemistry)
Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PLEKHA3
Alternative Gene Names
- FAPP1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 |
| Target Gene | PLEKHA3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (79%), Rat (77%) |
Antigen Sequence:
GSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.