CacheBy
Atlas Antibodies Anti-PLEK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLEK Antibody

상품 한눈에 보기

인체 PLEK 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. 정제된 PrEST 항원 기반 친화 정제 방식 사용. 토끼 유래 IgG 형태로, 인간에 높은 반응성을 보임. RNA-seq 및 재조합 발현 검증을 통해 신뢰성 확보.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057341-100 Anti-PLEK Antibody, pleckstrin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057341-25 Anti-PLEK Antibody, pleckstrin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLEK Antibody

Anti-PLEK Antibody

Target Protein: pleckstrin
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation: Orthogonal validation of protein expression using immunohistochemistry (IHC) by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB Recombinant Expression Validation: Recombinant expression validation in western blot (WB) using target protein overexpression.

Product Description

Polyclonal antibody against human PLEK.


Alternative Gene Names

  • P47

Open Datasheet


Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    VIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQGH

Verified Species Reactivity

  • Human

Interspecies Identity:
| Species | Ortholog ID | Identity (%) |
|----------|--------------|---------------|
| Mouse | ENSMUSG00000020120 | 89% |
| Rat | ENSRNOG00000005214 | 88% |


Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.