
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PLEK Antibody
상품 한눈에 보기
인체 PLEK 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. 정제된 PrEST 항원 기반 친화 정제 방식 사용. 토끼 유래 IgG 형태로, 인간에 높은 반응성을 보임. RNA-seq 및 재조합 발현 검증을 통해 신뢰성 확보.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057341-100 Anti-PLEK Antibody, pleckstrin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057341-25 Anti-PLEK Antibody, pleckstrin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PLEK Antibody
Anti-PLEK Antibody
Target Protein: pleckstrin
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using immunohistochemistry (IHC) by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB Recombinant Expression Validation: Recombinant expression validation in western blot (WB) using target protein overexpression.
Product Description
Polyclonal antibody against human PLEK.
Alternative Gene Names
- P47
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQGH
Verified Species Reactivity
- Human
Interspecies Identity:
| Species | Ortholog ID | Identity (%) |
|----------|--------------|---------------|
| Mouse | ENSMUSG00000020120 | 89% |
| Rat | ENSRNOG00000005214 | 88% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



