AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PLEC Antibody
상품 한눈에 보기
인간 PLEC 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. Rabbit 호스트에서 생산되었으며, PrEST 항원을 사용해 친화 정제되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA025967-100 Anti-PLEC Antibody, plectin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA025967-25 Anti-PLEC Antibody, plectin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PLEC Antibody
Anti-PLEC Antibody
제품 개요
- Target Protein: plectin
- Target Gene: PLEC
- Clonality: Polyclonal
- Host: Rabbit
- Isotype: IgG
- Recommended Applications: IHC, ICC
- Validation: Orthogonal validation using IHC compared to RNA-seq data in high and low expression tissues
제품 설명
Polyclonal antibody against human PLEC.
Alternative Gene Names
EBS1, PCN, PLEC1, PLTN
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LTGLSLLPLSEKAARARQEELYSELQARETFEKTPVEVPVGGFKGRTVTVWELISSEYFTAEQRQELLRQFRTGKVTVEKVIKILIT
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000023781 | 91% |
| Mouse | ENSMUSG00000022565 | 87% |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
사용 시 주의사항
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.