CacheBy
Atlas Antibodies Anti-PLCB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLCB2 Antibody

상품 한눈에 보기

Human PLCB2 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 ICC에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 40% 글리세롤 및 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068595-100 Anti-PLCB2 Antibody, phospholipase C beta 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068595-25 Anti-PLCB2 Antibody, phospholipase C beta 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLCB2 Antibody

Anti-PLCB2 Antibody

Target: phospholipase C, beta 2 (PLCB2)
Type: Polyclonal Antibody against Human PLCB2
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody targets human phospholipase C, beta 2 (PLCB2). It is affinity purified using the PrEST antigen as an affinity ligand, ensuring high specificity and reproducibility.


Alternative Gene Names

  • FLJ38135

Target Information

항목 내용
Target Protein phospholipase C, beta 2
Target Gene PLCB2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKESVRACLRTCFPSEAKDKPERACECPPELCEQDPL
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000040061 (75%), Rat ENSRNOG00000058337 (75%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen

Buffer Composition

성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.