CacheBy
Atlas Antibodies Anti-PLCB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLCB1 Antibody

상품 한눈에 보기

인간 PLCB1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 등 다양한 응용에 적합. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 재현성 제공. RNA-seq 데이터 기반 정교한 직교 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034743-100 Anti-PLCB1 Antibody, phospholipase C, beta 1 (phosphoinositide-specific) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034743-25 Anti-PLCB1 Antibody, phospholipase C, beta 1 (phosphoinositide-specific) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLCB1 Antibody

Anti-PLCB1 Antibody

phospholipase C, beta 1 (phosphoinositide-specific)


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human PLCB1


Alternative Gene Names

KIAA0581, PLC-I, PLC154

Open Datasheet


Target Information

항목 내용
Target Protein phospholipase C, beta 1 (phosphoinositide-specific)
Target Gene PLCB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NKKKSHKSSEGSGKKKLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVN
Verified Species Reactivity Human
Interspecies Information Highest antigen sequence identity to Rat ENSRNOG00000004810 (99%) and Mouse ENSMUSG00000051177 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.