AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PLAGL1 Antibody
상품 한눈에 보기
인간 PLAGL1 단백질을 인식하는 토끼 폴리클로날 항체. LOT1, ZAC 등 대체 유전자명으로도 알려짐. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. PBS와 글리세롤 버퍼에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055706-100 Anti-PLAGL1 Antibody, pleiomorphic adenoma gene-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055706-25 Anti-PLAGL1 Antibody, pleiomorphic adenoma gene-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PLAGL1 Antibody
Anti-PLAGL1 Antibody
Target: pleiomorphic adenoma gene-like 1 (PLAGL1)
Supplier: Atlas Antibodies
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human PLAGL1.
Alternative Gene Names
- LOT1
- ZAC
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | pleiomorphic adenoma gene-like 1 |
| Target Gene | PLAGL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | QELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000019817 (50%), Rat ENSRNOG00000025587 (47%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.