CacheBy
Atlas Antibodies Anti-PILRA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PILRA Antibody

상품 한눈에 보기

인간 PILRA 단백질에 대한 폴리클로날 항체로, 면역조직화학 등 다양한 연구용 응용에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증된 반응성을 가지며, 안정적인 PBS/glycerol 버퍼에 보존되어 있습니다.

카탈로그번호
HPA056132-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056132-100 Anti-PILRA Antibody, paired immunoglobin-like type 2 receptor alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056132-25 Anti-PILRA Antibody, paired immunoglobin-like type 2 receptor alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PILRA Antibody

Anti-PILRA Antibody

Target: Paired immunoglobin-like type 2 receptor alpha
Supplier: Atlas Antibodies


면역조직화학 (IHC) 등 다양한 연구용 응용에 적합

OCR 텍스트 (이미지 대체):
Recommended Applications


Product Description

Polyclonal Antibody against Human PILRA


Alternative Gene Names

  • FDF03

Open Datasheet


Target Information

항목 내용
Target Protein Paired immunoglobin-like type 2 receptor alpha
Target Gene PILRA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000033017 (57%), Mouse ENSMUSG00000089922 (50%)

Antigen Sequence

ALSSSTSPRAPPSHRPLKSPQNETLYSVLK

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.