CacheBy
Atlas Antibodies Anti-PIK3R4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PIK3R4 Antibody

상품 한눈에 보기

인간 PIK3R4 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. WB 및 IHC 분석에 적합하며, PrEST 항원으로 정제되었습니다. 높은 종간 보존성을 가지며, 40% 글리세롤과 PBS 완충액에 보존됩니다.

카탈로그번호
HPA036033-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036033-100 Anti-PIK3R4 Antibody, phosphoinositide-3-kinase, regulatory subunit 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036033-25 Anti-PIK3R4 Antibody, phosphoinositide-3-kinase, regulatory subunit 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PIK3R4 Antibody

Anti-PIK3R4 Antibody

Target Protein: phosphoinositide-3-kinase, regulatory subunit 4
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human PIK3R4.


Alternative Gene Names

  • p150
  • VPS15

Open Datasheet


Target Information

항목 내용
Target Protein phosphoinositide-3-kinase, regulatory subunit 4
Target Gene PIK3R4
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000013669 (100%), Mouse ENSMUSG00000032571 (100%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.