CacheBy
Atlas Antibodies Anti-PIGQ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PIGQ Antibody

상품 한눈에 보기

Human PIGQ 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 정제되었습니다. GPI anchor 생합성 관련 연구에 활용 가능합니다.

카탈로그번호
HPA039828-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039828-100 Anti-PIGQ Antibody, phosphatidylinositol glycan anchor biosynthesis, class Q 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039828-25 Anti-PIGQ Antibody, phosphatidylinositol glycan anchor biosynthesis, class Q 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PIGQ Antibody

Anti-PIGQ Antibody

Target: phosphatidylinositol glycan anchor biosynthesis, class Q
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human PIGQ


Alternative Gene Names

  • GPI1
  • hGPI1

Open Datasheet


Target Information

항목 내용
Target Protein phosphatidylinositol glycan anchor biosynthesis, class Q
Target Gene PIGQ
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000020140 (79%)
Mouse ENSMUSG00000025728 (77%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EDQVMLIFYDQRQVLLSQLHLPTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDE

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.