CacheBy
Atlas Antibodies Anti-PIGN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PIGN Antibody

상품 한눈에 보기

Human PIGN 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인체 반응성이 검증되어 신뢰성 높은 단백질 분석에 활용 가능합니다.

카탈로그번호
HPA039922-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039922-100 Anti-PIGN Antibody, phosphatidylinositol glycan anchor biosynthesis, class N 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039922-25 Anti-PIGN Antibody, phosphatidylinositol glycan anchor biosynthesis, class N 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PIGN Antibody

Anti-PIGN Antibody

Target Information

  • Target Protein: phosphatidylinositol glycan anchor biosynthesis, class N
  • Target Gene: PIGN
  • Alternative Gene Names: MDC4, PIG-N

Product Description

Polyclonal antibody against human PIGN protein.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
SWGISHTRVPTESRPGHVALIAGFYEDVSAVAKGWKENPVEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVYTYSYDAKREDFGAQDATKLDTW

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat: ENSRNOG00000014866 (97%)
  • Mouse: ENSMUSG00000056536 (97%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Applications IHC, ICC
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.