CacheBy
Atlas Antibodies Anti-PIGC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PIGC Antibody

상품 한눈에 보기

Human PIGC 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합. Rabbit 유래 IgG 항체이며 PrEST 항원으로 정제됨. 인체 외 Mouse 및 Rat에서도 높은 서열 유사성(97%)을 보임. 안정한 PBS/glycerol buffer에 보존됨.

카탈로그번호
HPA036663-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036663-100 Anti-PIGC Antibody, phosphatidylinositol glycan anchor biosynthesis, class C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036663-25 Anti-PIGC Antibody, phosphatidylinositol glycan anchor biosynthesis, class C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PIGC Antibody

Anti-PIGC Antibody

Target: phosphatidylinositol glycan anchor biosynthesis, class C
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human PIGC.

Open Datasheet (PDF)


Target Information

  • Target Protein: phosphatidylinositol glycan anchor biosynthesis, class C
  • Target Gene: PIGC
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    YLIRLQLFKENIHGPWDEAEIKEDLSRFLS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000026698): 97%
  • Rat (ENSRNOG00000026497): 97%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.