CacheBy
Atlas Antibodies Anti-PI3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PI3 Antibody

상품 한눈에 보기

Human PI3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 및 RNA-seq 비교를 통한 정교한 발현 검증 가능. PrEST 항원 기반 친화 정제. 40% 글리세롤 PBS 완충액에 보존. 피부 유래 peptidase inhibitor 3 연구에 적합.

카탈로그번호
HPA017737-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017737-100 Anti-PI3 Antibody, peptidase inhibitor 3, skin-derived 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017737-25 Anti-PI3 Antibody, peptidase inhibitor 3, skin-derived 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PI3 Antibody

Anti-PI3 Antibody

Target: peptidase inhibitor 3, skin-derived
Type: Polyclonal Antibody against Human PI3


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody developed against human PI3 (peptidase inhibitor 3, skin-derived).


Alternative Gene Names

cementoin, ELAFIN, ESI, SKALP, WAP3, WFDC14

Open Datasheet


Antigen Information

Antigen Sequence (PrEST antigen):

KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000017002 31%
Rat ENSRNOG00000046699 31%

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.