
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PHYKPL Antibody
상품 한눈에 보기
Human PHYKPL 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 WB에 적합합니다. Recombinant PrEST 항원을 이용해 affinity purification 되었으며, human, mouse, rat에서 반응이 검증되었습니다. PBS/glycerol buffer에 sodium azide 보존제를 포함합니다.
- 카탈로그번호
- HPA036461-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036461-100 Anti-PHYKPL Antibody, 5-phosphohydroxy-L-lysine phospho-lyase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036461-25 Anti-PHYKPL Antibody, 5-phosphohydroxy-L-lysine phospho-lyase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PHYKPL Antibody
Anti-PHYKPL Antibody
Target Information
- Protein: 5-phosphohydroxy-L-lysine phospho-lyase
- Gene: PHYKPL
- Alternative Gene Names: AGXT2L2, MGC15875
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human PHYKPL.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:TRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEKVRSCETL
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000047933 | 91% |
| Mouse | ENSMUSG00000020359 | 86% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



