CacheBy
Atlas Antibodies Anti-PHYKPL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PHYKPL Antibody

상품 한눈에 보기

Human PHYKPL 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 WB에 적합합니다. Recombinant PrEST 항원을 이용해 affinity purification 되었으며, human, mouse, rat에서 반응이 검증되었습니다. PBS/glycerol buffer에 sodium azide 보존제를 포함합니다.

카탈로그번호
HPA036461-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036461-100 Anti-PHYKPL Antibody, 5-phosphohydroxy-L-lysine phospho-lyase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036461-25 Anti-PHYKPL Antibody, 5-phosphohydroxy-L-lysine phospho-lyase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PHYKPL Antibody

Anti-PHYKPL Antibody

Target Information

  • Protein: 5-phosphohydroxy-L-lysine phospho-lyase
  • Gene: PHYKPL
  • Alternative Gene Names: AGXT2L2, MGC15875
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human PHYKPL.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
TRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEKVRSCETL

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000047933 91%
Mouse ENSMUSG00000020359 86%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.