CacheBy
Atlas Antibodies Anti-PHF24 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PHF24 Antibody

상품 한눈에 보기

Human PHF24 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, IHC 등 다양한 응용에 적합합니다. Glycerol/PBS buffer에 보존되어 장기 안정성이 우수합니다.

카탈로그번호
HPA020974-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020974-100 Anti-PHF24 Antibody, PHD finger protein 24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020974-25 Anti-PHF24 Antibody, PHD finger protein 24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PHF24 Antibody

Anti-PHF24 Antibody

Target Information

  • Target Protein: PHD finger protein 24
  • Target Gene: PHF24
  • Alternative Gene Names: KIAA1045
  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human PHF24.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LLTEEEMYSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALSEEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000000129): 94%
  • Mouse (ENSMUSG00000036062): 89%

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

관련 자료

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.