Atlas Antibodies Anti-PHF2 Antibody

상품 한눈에 보기

인간 PHF2 단백질을 인식하는 토끼 다클론 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA010831-100 Anti-PHF2 Antibody, PHD finger protein 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA010831-25 Anti-PHF2 Antibody, PHD finger protein 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human PHF2. Suitable for various immunoassay applications.

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
LEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLEKSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGVFGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAPKRDLSFLLDKKAVLPTPVTKPKLD

Verified Species: Human
Interspecies Information:
- Mouse (ENSMUSG00000038025): 90% identity
- Rat (ENSRNOG00000016816): 88% identity

항목	내용
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage & Handling	Gently mix before use. Optimal concentrations and conditions should be determined by the user.