CacheBy
Atlas Antibodies Anti-PHAX Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PHAX Antibody

상품 한눈에 보기

인간 PHAX 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 응용에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공. RNA 수출 관련 단백질 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059630-100 Anti-PHAX Antibody, phosphorylated adaptor for RNA export 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059630-25 Anti-PHAX Antibody, phosphorylated adaptor for RNA export 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PHAX Antibody

Anti-PHAX Antibody

Target: phosphorylated adaptor for RNA export (PHAX)
Type: Polyclonal Antibody against Human PHAX


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against the human phosphorylated adaptor for RNA export (PHAX) protein.


Alternative Gene Names

  • FLJ13193
  • RNUXA

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein phosphorylated adaptor for RNA export
Target Gene PHAX
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAVESVDSSEESFSDSDDDSCLWKRKRQKC
Verified Species Reactivity Human
Ortholog Identity Mouse (72%), Rat (69%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.