AI 생성

1 / 2

Atlas Antibodies Anti-PHACTR3 Antibody

상품 한눈에 보기

인간 PHACTR3 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형태이며, PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증되어 있으며, 다양한 면역학적 응용에 적합. 안정적인 PBS/glycerol 버퍼에 보존됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051834-100 Anti-PHACTR3 Antibody, phosphatase and actin regulator 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051834-25 Anti-PHACTR3 Antibody, phosphatase and actin regulator 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

phosphatase and actin regulator 3

면역세포화학(ICC)

Polyclonal Antibody against Human PHACTR3

C20orf101, PPP1R123

항목	내용
Target Protein	phosphatase and actin regulator 3
Target Gene	PHACTR3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000027525 (79%), Rat ENSRNOG00000057996 (67%)

Antigen Sequence:

KLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGS

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Recommended Applications - ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.