CacheBy
Atlas Antibodies Anti-PHACTR3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PHACTR3 Antibody

상품 한눈에 보기

인간 PHACTR3 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형태이며, PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증되어 있으며, 다양한 면역학적 응용에 적합. 안정적인 PBS/glycerol 버퍼에 보존됨.

카탈로그번호
HPA051834-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051834-100 Anti-PHACTR3 Antibody, phosphatase and actin regulator 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051834-25 Anti-PHACTR3 Antibody, phosphatase and actin regulator 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PHACTR3 Antibody

Anti-PHACTR3 Antibody

phosphatase and actin regulator 3


면역세포화학(ICC)


Product Description

Polyclonal Antibody against Human PHACTR3


Alternative Gene Names

C20orf101, PPP1R123

Open Datasheet


Target Information

항목 내용
Target Protein phosphatase and actin regulator 3
Target Gene PHACTR3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000027525 (79%), Rat ENSRNOG00000057996 (67%)

Antigen Sequence:

KLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGS

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.