CacheBy
Atlas Antibodies Anti-PGRMC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PGRMC1 Antibody

상품 한눈에 보기

Human PGRMC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교 검증 완료. Human, Mouse, Rat에 반응하며 PrEST 항원으로 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064724-100 Anti-PGRMC1 Antibody, progesterone receptor membrane component 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064724-25 Anti-PGRMC1 Antibody, progesterone receptor membrane component 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PGRMC1 Antibody

Anti-PGRMC1 Antibody

Target: progesterone receptor membrane component 1 (PGRMC1)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation)
  • WB (Western Blot)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human PGRMC1.


Alternative Gene Names

  • HPR6.6

Open Datasheet


Specifications

항목 내용
Target Protein Progesterone receptor membrane component 1
Target Gene PGRMC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000006373 (97%), Rat ENSRNOG00000012786 (95%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.