
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PGC Antibody
상품 한눈에 보기
Human PGC(progastricsin/pepsinogen C)을 타겟으로 하는 Rabbit Polyclonal Antibody. IHC 및 WB에서 검증됨. Recombinant Epitope 기반 정제. Human에 특이적 반응성을 보이며, Orthogonal 및 Recombinant Expression Validation 수행.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031717-100 Anti-PGC Antibody, progastricsin (pepsinogen C) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031717-25 Anti-PGC Antibody, progastricsin (pepsinogen C) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PGC Antibody
Anti-PGC Antibody
Target: progastricsin (pepsinogen C)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot): Recombinant expression validation using target protein overexpression.
Product Description
Polyclonal Antibody against Human PGC (progastricsin/pepsinogen C).
Validated for IHC and WB applications.
Affinity purified using recombinant PrEST antigen.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | progastricsin (pepsinogen C) |
| Target Gene | PGC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGT |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000014492 (75%), Mouse ENSMUSG00000023987 (73%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



