CacheBy
Atlas Antibodies Anti-PGC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PGC Antibody

상품 한눈에 보기

Human PGC(progastricsin/pepsinogen C)을 타겟으로 하는 Rabbit Polyclonal Antibody. IHC 및 WB에서 검증됨. Recombinant Epitope 기반 정제. Human에 특이적 반응성을 보이며, Orthogonal 및 Recombinant Expression Validation 수행.

카탈로그번호
HPA031717-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031717-100 Anti-PGC Antibody, progastricsin (pepsinogen C) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031717-25 Anti-PGC Antibody, progastricsin (pepsinogen C) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PGC Antibody

Anti-PGC Antibody

Target: progastricsin (pepsinogen C)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Recombinant expression validation using target protein overexpression.

Product Description

Polyclonal Antibody against Human PGC (progastricsin/pepsinogen C).
Validated for IHC and WB applications.
Affinity purified using recombinant PrEST antigen.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein progastricsin (pepsinogen C)
Target Gene PGC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGT
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000014492 (75%), Mouse ENSMUSG00000023987 (73%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.