Atlas Antibodies Anti-PFN2 Antibody

상품 한눈에 보기

Human PFN2 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 WB에서 Orthogonal validation 수행. Recombinant PrEST 항원으로 정제됨. 인간, 생쥐, 랫트 반응성 확인. 40% glycerol 기반 PBS buffer에 sodium azide 보존제 포함.

카탈로그번호: HPA035611-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035611-100 Anti-PFN2 Antibody, profilin 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035611-25 Anti-PFN2 Antibody, profilin 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PFN2 Antibody

Anti-PFN2 Antibody

Target Protein: profilin 2
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human PFN2
Open Datasheet

Specifications

항목	내용
Target Protein	profilin 2
Target Gene	PFN2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	QEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRD
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Mouse ENSMUSG00000027805 (98%), Rat ENSRNOG00000017427 (93%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.