
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PEX16 Antibody
상품 한눈에 보기
Human 및 Mouse에서 반응하는 Anti-PEX16 Polyclonal Antibody. PEX16 단백질 인식. IHC 및 WB에 적합. Rabbit에서 생산된 IgG, PrEST 항원으로 친화 정제됨. 40% glycerol/PBS buffer 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043286-100 Anti-PEX16 Antibody, peroxisomal biogenesis factor 16 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043286-25 Anti-PEX16 Antibody, peroxisomal biogenesis factor 16 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PEX16 Antibody
Anti-PEX16 Antibody
Target: Peroxisomal biogenesis factor 16 (PEX16)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human PEX16 protein.
Validated for use in IHC and WB applications.
For research use only.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Peroxisomal biogenesis factor 16 |
| Target Gene | PEX16 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | AGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAE |
| Verified Species Reactivity | Human, Mouse |
| Interspecies Information | Rat ENSRNOG00000006539 (83%), Mouse ENSMUSG00000027222 (83%) |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



