CacheBy
Atlas Antibodies Anti-PES1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PES1 Antibody

상품 한눈에 보기

인간 PES1 단백질을 표적으로 하는 폴리클로날 토끼 항체. WB 및 ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 인간에 검증된 반응성과 마우스, 랫트 간 높은 서열 동일성 보유.

카탈로그번호
HPA066670-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066670-100 Anti-PES1 Antibody, pescadillo ribosomal biogenesis factor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066670-25 Anti-PES1 Antibody, pescadillo ribosomal biogenesis factor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PES1 Antibody

Anti-PES1 Antibody

Target: pescadillo ribosomal biogenesis factor 1 (PES1)
Supplier: Atlas Antibodies


  • Western Blot (WB)
    • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PES1.


Alternative Gene Names

  • PES

Target Information

항목 내용
Target Protein pescadillo ribosomal biogenesis factor 1
Target Gene PES1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000020430 (93%), Rat ENSRNOG00000004515 (92%)

Antigen Sequence:

RMEGKKPRVMAGTLKLEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANKLAEKRKAHDE

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet


제품 이미지

Enhanced Validation
WB Validation
Independent Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.