CacheBy
Atlas Antibodies Anti-PES1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PES1 Antibody

상품 한눈에 보기

Human PES1 단백질을 표적으로 하는 폴리클로날 토끼 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간에서 검증되었으며 마우스 및 랫트와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040210-100 Anti-PES1 Antibody, pescadillo ribosomal biogenesis factor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040210-25 Anti-PES1 Antibody, pescadillo ribosomal biogenesis factor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PES1 Antibody

Anti-PES1 Antibody

Target: pescadillo ribosomal biogenesis factor 1 (PES1)
Supplier: Atlas Antibodies


  • Western Blot (WB) – Independent validation using antibodies targeting different epitopes
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PES1.


Alternative Gene Names

  • PES

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein pescadillo ribosomal biogenesis factor 1
Target Gene PES1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000020430 (93%), Rat ENSRNOG00000004515 (92%)

Antigen Sequence:
RMEGKKPRVMAGTLKLEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANKLAEKRKAHDE


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.