CacheBy
Atlas Antibodies Anti-PEPD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PEPD Antibody

상품 한눈에 보기

Human PEPD 단백질을 타깃으로 하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 제공합니다. 인간, 마우스, 랫트에 반응하며, Orthogonal validation으로 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015599-100 Anti-PEPD Antibody, peptidase D 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015599-25 Anti-PEPD Antibody, peptidase D 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PEPD Antibody

Anti-PEPD Antibody

Target: peptidase D (PEPD)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation using RNA-seq data comparison in high and low expression tissues)
  • WB
  • ICC

Product Description

Polyclonal antibody against Human PEPD.
Validated for multiple applications with enhanced validation for protein expression.

Open Datasheet


Target Information

항목 내용
Target Protein peptidase D
Target Gene PEPD
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Mouse ENSMUSG00000063931 (90%), Rat ENSRNOG00000019196 (36%)

Antigen Sequence:

ITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDE

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.