Atlas Antibodies Anti-PDS5B Antibody

상품 한눈에 보기

Human PDS5B 단백질을 인식하는 고품질 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원 기반으로 정제됨. Human에 대해 검증된 반응성을 제공하며, 안정적인 PBS/glycerol 버퍼에 보존됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039513-100 Anti-PDS5B Antibody, PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039513-25 Anti-PDS5B Antibody, PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)

Polyclonal antibody against Human PDS5B

APRIN, AS3, CG008, FLJ23236, KIAA0979

항목	내용
Target Protein	PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
Target Gene	PDS5B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000001098 (81%), Mouse ENSMUSG00000034021 (78%)

Antigen Sequence:

ESPESSAIESTQSTPQKGRGRPSKTPSPSQPKKNVRVGRSKQAATKENDSSEEVDVFQGSSPVDDIPQEETEEEEVSTVNVRRRSAKRER

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)