Atlas Antibodies Anti-PDRG1 Antibody

상품 한눈에 보기

인간 PDRG1 단백질을 인식하는 폴리클로날 항체로, p53 및 DNA 손상 조절 관련 연구에 적합함. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간 반응성이 검증되어 있으며 IHC 등 다양한 응용 가능.

카탈로그번호: HPA047084-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047084-100 Anti-PDRG1 Antibody, p53 and DNA-damage regulated 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047084-25 Anti-PDRG1 Antibody, p53 and DNA-damage regulated 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PDRG1 Antibody

Anti-PDRG1 Antibody

Target Information

Protein: p53 and DNA-damage regulated 1
Gene: PDRG1
Alternative Gene Names: C20orf126, dJ310O13.3

Product Description

Polyclonal antibody against human PDRG1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLN

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000027472 (93%)
Rat ENSRNOG00000008845 (89%)

Technical Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	Immunohistochemistry (IHC)
Material Safety Data Sheet	MSDS - Sodium Azide