Atlas Antibodies Anti-PDLIM7 Antibody

상품 한눈에 보기

Human PDLIM7 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원을 사용해 높은 특이성과 재현성을 보장하며, Orthogonal validation으로 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA048815-100 Anti-PDLIM7 Antibody, PDZ and LIM domain 7 (enigma) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA048815-25 Anti-PDLIM7 Antibody, PDZ and LIM domain 7 (enigma) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

PDZ and LIM domain 7 (enigma)

IHC (Immunohistochemistry)
WB (Western Blot, Orthogonal validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human PDLIM7

항목	내용
Target Protein	PDZ and LIM domain 7 (enigma)
Target Gene	PDLIM7
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	HLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTR
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000013653 (92%), Mouse ENSMUSG00000021493 (92%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet