CacheBy
Atlas Antibodies Anti-PDIA6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PDIA6 Antibody

상품 한눈에 보기

Human PDIA6 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal 및 Genetic Validation을 통해 신뢰성 검증 완료. Rabbit 유래 IgG, Affinity purified 형태로 제공됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA034652-100 Anti-PDIA6 Antibody, protein disulfide isomerase family A, member 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034652-25 Anti-PDIA6 Antibody, protein disulfide isomerase family A, member 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PDIA6 Antibody

Anti-PDIA6 Antibody

Target: protein disulfide isomerase family A, member 6
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Genetic Validation): Genetic validation in Western Blot by siRNA knockdown.

Product Description

Polyclonal Antibody against Human PDIA6


Alternative Gene Names

ERp5, P5, TXNDC7

Open Datasheet


Target Information

항목 내용
Target Protein protein disulfide isomerase family A, member 6
Target Gene PDIA6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence YGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLA
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000020571 (98%), Rat ENSRNOG00000050197 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Genetic

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.