
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PDHX Antibody
상품 한눈에 보기
인체 PDHX 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증을 통해 높은 신뢰성을 제공. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 정제. 인간 반응성이 검증되어 다양한 생물학 연구에 적합.
- 카탈로그번호
- HPA038485-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038485-100 Anti-PDHX Antibody, pyruvate dehydrogenase complex, component X 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038485-25 Anti-PDHX Antibody, pyruvate dehydrogenase complex, component X 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PDHX Antibody
Anti-PDHX Antibody
Target: Pyruvate dehydrogenase complex, component X
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation (IHC): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- Independent validation (WB): Protein expression validated using independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human PDHX.
Alternative Gene Names
DLDBP, E3BP, OPDX, PDX1, proX
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Pyruvate dehydrogenase complex, component X |
| Target Gene | PDHX |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (76%), Rat (71%) |
Antigen Sequence:
DASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLS
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



