
1 / 2
Atlas Antibodies Anti-PDHX Antibody
상품 한눈에 보기
인체 PDHX 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증을 통해 높은 신뢰성을 제공. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 정제. 인간 반응성이 검증되어 다양한 생물학 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PDHX Antibody
Target: Pyruvate dehydrogenase complex, component X
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation (IHC): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- Independent validation (WB): Protein expression validated using independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human PDHX.
Alternative Gene Names
DLDBP, E3BP, OPDX, PDX1, proX
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Pyruvate dehydrogenase complex, component X |
| Target Gene | PDHX |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (76%), Rat (71%) |
Antigen Sequence:
DASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLS
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.




