CacheBy
Atlas Antibodies Anti-PDE8B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PDE8B Antibody

상품 한눈에 보기

Human PDE8B 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. 인체 유래 phosphodiesterase 8B 단백질 검출에 적합. 다양한 응용 분야에서 사용 가능하며, 40% glycerol/PBS buffer로 안정화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036911-100 Anti-PDE8B Antibody, phosphodiesterase 8B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036911-25 Anti-PDE8B Antibody, phosphodiesterase 8B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PDE8B Antibody

Anti-PDE8B Antibody

Target Information

  • Target Protein: phosphodiesterase 8B
  • Target Gene: PDE8B
  • Antigen Sequence:
    Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    RRHCCSSAEAETQTCYTSVKQVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLD
  • ICC (Immunocytochemistry) 등 다양한 응용에 적합

Product Description

Polyclonal antibody against Human PDE8B.
Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000021684 99%
Rat ENSRNOG00000010280 62%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 조건에 맞는 최적 농도는 사용자가 직접 설정해야 합니다.

제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.