Atlas Antibodies Anti-PDCL3 Antibody

상품 한눈에 보기

인간 PDCL3 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 발현 검증 완료, 친화도 정제 방식으로 높은 특이성과 신뢰성을 제공합니다. 토끼 유래 IgG 형식이며, PBS/glycerol 완충액에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA018469-100 Anti-PDCL3 Antibody, phosducin-like 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA018469-25 Anti-PDCL3 Antibody, phosducin-like 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: phosducin-like 3 (PDCL3)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
WB (Western Blot, recombinant expression validation using target protein overexpression)
ICC (Immunocytochemistry)

Polyclonal antibody against human PDCL3.

항목	내용
Target Protein	phosducin-like 3
Target Gene	PDCL3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	IGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000026078 (84%), Rat ENSRNOG00000013286 (84%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet