
원본
Atlas Antibodies Anti-C1QL2 Antibody
상품 한눈에 보기
Human C1QL2 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간에 대한 반응성이 검증되었습니다.
- 카탈로그번호
- HPA057934-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057934-100 Anti-C1QL2 Antibody, complement component 1, q subcomponent-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057934-25 Anti-C1QL2 Antibody, complement component 1, q subcomponent-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C1QL2 Antibody
Anti-C1QL2 Antibody
Target: complement component 1, q subcomponent-like 2
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human C1QL2
Alternative Gene Names
C1QTNF10, CTRP10
Target Information
- Target Protein: complement component 1, q subcomponent-like 2
- Target Gene: C1QL2
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
CRMICDPYTAAPGGEPPGAKAQPPGPSTAALEVMQDLSANPPPPFIQGPKGD
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000036907 | 88% |
| Rat | ENSRNOG00000046863 | 85% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



