CacheBy
Atlas Antibodies Anti-C19orf35 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C19orf35 Antibody

상품 한눈에 보기

Human C19orf35 단백질을 인식하는 폴리클로날 토끼 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 고순도 IgG 포맷으로 제공되며, PBS/glycerol buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA057806-100 Anti-C19orf35 Antibody, chromosome 19 open reading frame 35 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057806-25 Anti-C19orf35 Antibody, chromosome 19 open reading frame 35 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C19orf35 Antibody

Anti-C19orf35 Antibody

Target: chromosome 19 open reading frame 35 (C19orf35)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human C19orf35


Alternative Gene Names

  • FLJ45778

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 19 open reading frame 35
Target Gene C19orf35
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AAEVPERTVAQWLAEACTQPPEEFVWAVALLLLQLSAALKFLEAWGAALVELRPENLL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000074305 36%
Rat ENSRNOG00000042519 36%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.