CacheBy
Atlas Antibodies Anti-C18orf21 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C18orf21 Antibody

상품 한눈에 보기

Human C18orf21 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간에 반응하며, 마우스 및 랫과 유사 서열 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA065505-100 Anti-C18orf21 Antibody, chromosome 18 open reading frame 21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065505-25 Anti-C18orf21 Antibody, chromosome 18 open reading frame 21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C18orf21 Antibody

Anti-C18orf21 Antibody

Target: chromosome 18 open reading frame 21 (C18orf21)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human C18orf21.


Alternative Gene Names

HsT3108, PNAS-124, PNAS-131

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 18 open reading frame 21
Target Gene C18orf21
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GQSVSTCSSKNTSKTKKHFSQLKMLLSQNESQKIPKVDFRNFLSSLKGGLL

Species Reactivity

종 반응성
Human Verified
Mouse 65% sequence identity (ENSMUSG00000024273)
Rat 63% sequence identity (ENSRNOG00000015546)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

성분 내용
Buffer PBS (pH 7.2) with 40% glycerol
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.