
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C18orf21 Antibody
상품 한눈에 보기
Human C18orf21 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간에 반응하며, 마우스 및 랫과 유사 서열 보유.
- 카탈로그번호
- HPA065505-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA065505-100 Anti-C18orf21 Antibody, chromosome 18 open reading frame 21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065505-25 Anti-C18orf21 Antibody, chromosome 18 open reading frame 21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C18orf21 Antibody
Anti-C18orf21 Antibody
Target: chromosome 18 open reading frame 21 (C18orf21)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human C18orf21.
Alternative Gene Names
HsT3108, PNAS-124, PNAS-131
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 18 open reading frame 21 |
| Target Gene | C18orf21 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GQSVSTCSSKNTSKTKKHFSQLKMLLSQNESQKIPKVDFRNFLSSLKGGLL |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse | 65% sequence identity (ENSMUSG00000024273) |
| Rat | 63% sequence identity (ENSRNOG00000015546) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 성분 | 내용 |
|---|---|
| Buffer | PBS (pH 7.2) with 40% glycerol |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



