CacheBy
Atlas Antibodies Anti-C17orf107 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C17orf107 Antibody

상품 한눈에 보기

Human C17orf107 단백질을 인식하는 폴리클로날 래빗 항체로, IHC 및 ICC에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 인간에서 검증되었으며, 쥐 및 생쥐와 67% 서열 일치.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA069713-100 Anti-C17orf107 Antibody, chromosome 17 open reading frame 107 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069713-25 Anti-C17orf107 Antibody, chromosome 17 open reading frame 107 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C17orf107 Antibody

Anti-C17orf107 Antibody

Target: chromosome 17 open reading frame 107
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human C17orf107.

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 17 open reading frame 107
Target Gene C17orf107
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000042847 (67%), Mouse ENSMUSG00000087279 (67%)

Antigen Sequence:
SARLLVQGAWLCLCGRGLQGSASFLRQSQQQLGLGIPGEPVSSGH


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.