Atlas Antibodies Anti-C16orf59 Antibody

상품 한눈에 보기

Human C16orf59 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학(ICC) 등 다양한 연구용 응용에 적합. 고순도 친화 정제 방식으로 제조되었으며, 인간에 특이적 반응성을 검증함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051394-100 Anti-C16orf59 Antibody, chromosome 16 open reading frame 59 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051394-25 Anti-C16orf59 Antibody, chromosome 16 open reading frame 59 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

면역세포화학 (ICC) 등 다양한 면역학적 분석에 사용 가능.

Polyclonal antibody against human C16orf59.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

CSLLRLRMREELSAAPMDWMQEYRCLLTLEGLQAMVGQCLHRLQELRAAVAEQPPRPCPVGRPPGASPSCGGRAEPAWSPQLLVYSST

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.