AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C11orf84 Antibody
상품 한눈에 보기
인간 C11orf84 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 WB 실험에 적합하며, PrEST 항원을 이용해 친화 정제됨. 사람과 마우스 모두 반응성이 검증됨. 안정적 PBS/glycerol 버퍼에 보존제로 sodium azide 포함.
- 카탈로그번호
- HPA050313-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050313-100 Anti-C11orf84 Antibody, chromosome 11 open reading frame 84 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050313-25 Anti-C11orf84 Antibody, chromosome 11 open reading frame 84 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C11orf84 Antibody
Anti-C11orf84 Antibody
Target Information
- Target Protein: Chromosome 11 open reading frame 84
- Target Gene: C11orf84
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQVSWEQEFLVGSSPGGSGRALCMVCGAEIRAPS
Verified Species Reactivity
- Human
- Mouse
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000025061 | 89% |
| Mouse | ENSMUSG00000024970 | 88% |
Clonality and Host
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
| Component | Description |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.