CacheBy
Atlas Antibodies Anti-C11orf84 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf84 Antibody

상품 한눈에 보기

인간 C11orf84 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 WB 실험에 적합하며, PrEST 항원을 이용해 친화 정제됨. 사람과 마우스 모두 반응성이 검증됨. 안정적 PBS/glycerol 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA050313-100 Anti-C11orf84 Antibody, chromosome 11 open reading frame 84 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050313-25 Anti-C11orf84 Antibody, chromosome 11 open reading frame 84 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf84 Antibody

Anti-C11orf84 Antibody

Target Information

  • Target Protein: Chromosome 11 open reading frame 84
  • Target Gene: C11orf84
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    DCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQVSWEQEFLVGSSPGGSGRALCMVCGAEIRAPS

Verified Species Reactivity

  • Human
  • Mouse

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000025061 89%
Mouse ENSMUSG00000024970 88%

Clonality and Host

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

Component Description
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.