CacheBy
Atlas Antibodies Anti-C11orf84 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf84 Antibody

상품 한눈에 보기

Human C11orf84 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western Blot에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이도와 재현성 제공. 사람과 생쥐 시료 모두에 반응하며, 안정한 PBS/glycerol buffer로 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040128-100 Anti-C11orf84 Antibody, chromosome 11 open reading frame 84 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040128-25 Anti-C11orf84 Antibody, chromosome 11 open reading frame 84 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf84 Antibody

Anti-C11orf84 Antibody

Target: chromosome 11 open reading frame 84 (C11orf84)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human C11orf84.
Affinity purified using PrEST antigen as affinity ligand.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 11 open reading frame 84
Target Gene C11orf84
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence DCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQVSWEQEFLVGSSPGGSGRALCMVCGAEIRAPS

Species Reactivity

항목 내용
Verified Reactivity Human, Mouse
Ortholog Identity Rat ENSRNOG00000025061 (89%)
Mouse ENSMUSG00000024970 (88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.