
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C11orf84 Antibody
상품 한눈에 보기
Human C11orf84 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western Blot에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이도와 재현성 제공. 사람과 생쥐 시료 모두에 반응하며, 안정한 PBS/glycerol buffer로 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA040128-100 Anti-C11orf84 Antibody, chromosome 11 open reading frame 84 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040128-25 Anti-C11orf84 Antibody, chromosome 11 open reading frame 84 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C11orf84 Antibody
Anti-C11orf84 Antibody
Target: chromosome 11 open reading frame 84 (C11orf84)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human C11orf84.
Affinity purified using PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 11 open reading frame 84 |
| Target Gene | C11orf84 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | DCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQVSWEQEFLVGSSPGGSGRALCMVCGAEIRAPS |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human, Mouse |
| Ortholog Identity | Rat ENSRNOG00000025061 (89%) Mouse ENSMUSG00000024970 (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using PrEST antigen |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



