CacheBy
Atlas Antibodies Anti-BTG4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BTG4 Antibody

상품 한눈에 보기

인간 BTG4 단백질을 인식하는 토끼 폴리클로날 항체. 면역세포 연구 및 단백질 발현 분석에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. PBS와 글리세롤 완충액에 보존제 첨가.

카탈로그번호
HPA057157-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057157-100 Anti-BTG4 Antibody, B-cell translocation gene 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057157-25 Anti-BTG4 Antibody, B-cell translocation gene 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BTG4 Antibody

Anti-BTG4 Antibody

제품 설명

Polyclonal Antibody against Human BTG4 (B-cell translocation gene 4)

Alternative Gene Names

  • PC3B

Open Datasheet

항원 정보

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000011277 (89%)
  • Mouse ENSMUSG00000032056 (87%)

권장 응용 분야

면역세포 염색 (ICC) 등 다양한 면역학적 분석에 사용 가능.

제품 사양

항목 내용
Target Protein B-cell translocation gene 4
Target Gene BTG4
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

주의사항

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자에 의해 결정되어야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.