Atlas Antibodies Anti-BRE Antibody

상품 한눈에 보기

Human BRE 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Recombinant expression validation을 통해 검증되었으며, BRCC4/BRCC45 유전자와 관련된 연구에 활용 가능합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호: HPA017926-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA017926-100 Anti-BRE Antibody, brain and reproductive organ-expressed (TNFRSF1A modulator) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA017926-25 Anti-BRE Antibody, brain and reproductive organ-expressed (TNFRSF1A modulator) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-BRE Antibody

Anti-BRE Antibody

Target: brain and reproductive organ-expressed (TNFRSF1A modulator)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot, recombinant expression validation)
ICC (Immunocytochemistry)

Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human BRE.

Alternative Gene Names

BRCC4
BRCC45

Open Datasheet

Target Information

항목	내용
Target Protein	brain and reproductive organ-expressed (TNFRSF1A modulator)
Target Gene	BRE
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	ALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALQNLA

Species Reactivity

항목	내용
Verified Species	Human
Ortholog Identity	Rat ENSRNOG00000004364 (99%), Mouse ENSMUSG00000052139 (99%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)