CacheBy
Atlas Antibodies Anti-BRE Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BRE Antibody

상품 한눈에 보기

Human BRE 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Recombinant expression validation을 통해 검증되었으며, BRCC4/BRCC45 유전자와 관련된 연구에 활용 가능합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA017926-100 Anti-BRE Antibody, brain and reproductive organ-expressed (TNFRSF1A modulator) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017926-25 Anti-BRE Antibody, brain and reproductive organ-expressed (TNFRSF1A modulator) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BRE Antibody

Anti-BRE Antibody

Target: brain and reproductive organ-expressed (TNFRSF1A modulator)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, recombinant expression validation)
  • ICC (Immunocytochemistry)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human BRE.


Alternative Gene Names

  • BRCC4
  • BRCC45

Open Datasheet


Target Information

항목 내용
Target Protein brain and reproductive organ-expressed (TNFRSF1A modulator)
Target Gene BRE
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALQNLA

Species Reactivity

항목 내용
Verified Species Human
Ortholog Identity Rat ENSRNOG00000004364 (99%), Mouse ENSMUSG00000052139 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.