CacheBy
Atlas Antibodies Anti-BOP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BOP1 Antibody

상품 한눈에 보기

Human BOP1 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 대한 검증된 반응성을 가지며, Mouse 및 Rat과 높은 서열 유사성을 보입니다.

카탈로그번호
HPA047869-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047869-100 Anti-BOP1 Antibody, block of proliferation 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047869-25 Anti-BOP1 Antibody, block of proliferation 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BOP1 Antibody

Anti-BOP1 Antibody

Target: Block of Proliferation 1 (BOP1)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human BOP1.

Alternative Gene Names

  • KIAA0124

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Block of proliferation 1
Target Gene BOP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000022557 (90%)
Rat ENSRNOG00000021773 (89%)

Clonality and Host

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

PLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPDYWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEP

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.