Atlas Antibodies Anti-BMP1 Antibody

상품 한눈에 보기

Human BMP1 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다.

카탈로그번호: HPA014572-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA014572-100 Anti-BMP1 Antibody, bone morphogenetic protein 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA014572-25 Anti-BMP1 Antibody, bone morphogenetic protein 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-BMP1 Antibody

Anti-BMP1 Antibody

Target: bone morphogenetic protein 1 (BMP1)
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human BMP1 (bone morphogenetic protein 1).
Validated through orthogonal comparison of IHC protein expression with RNA-seq data in tissues showing high and low expression levels.

Alternative Gene Names

PCOLC

Target Information

항목	내용
Target Protein	bone morphogenetic protein 1
Target Gene	BMP1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000022098 (80%), Rat ENSRNOG00000010890 (80%)

Antigen Sequence:
DSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGS

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand