CacheBy
Atlas Antibodies Anti-BLZF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BLZF1 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-BLZF1 항체는 인간 BLZF1 단백질을 표적으로 하는 고품질 폴리클로날 항체입니다. IHC 및 WB 분석에 적합하며, RNA-seq 데이터 기반 Orthogonal 검증을 통해 신뢰성을 확보했습니다. Rabbit 유래 IgG로, PrEST 항원 친화 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA025703-100 Anti-BLZF1 Antibody, basic leucine zipper nuclear factor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA025703-25 Anti-BLZF1 Antibody, basic leucine zipper nuclear factor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BLZF1 Antibody

Anti-BLZF1 Antibody

basic leucine zipper nuclear factor 1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Orthogonal validation:
Protein expression verified using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human BLZF1


Alternative Gene Names

  • JEM-1

Open Datasheet


Target Information

항목 내용
Target Protein basic leucine zipper nuclear factor 1
Target Gene BLZF1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000002884 (87%), Mouse ENSMUSG00000026577 (85%)

Antigen Sequence:
KSLGHHKGEFLGQSEGVIEPNKELSEVKNVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDLQYHFERLARE


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.