CacheBy
Atlas Antibodies Anti-BLZF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BLZF1 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-BLZF1 항체는 인간 BLZF1 단백질을 표적으로 하는 고품질 폴리클로날 항체입니다. IHC 및 WB 분석에 적합하며, RNA-seq 데이터 기반 Orthogonal 검증을 통해 신뢰성을 확보했습니다. Rabbit 유래 IgG로, PrEST 항원 친화 정제 방식으로 제조되었습니다.

카탈로그번호
HPA025703-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA025703-100 Anti-BLZF1 Antibody, basic leucine zipper nuclear factor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA025703-25 Anti-BLZF1 Antibody, basic leucine zipper nuclear factor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BLZF1 Antibody

Anti-BLZF1 Antibody

basic leucine zipper nuclear factor 1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Orthogonal validation:
Protein expression verified using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human BLZF1


Alternative Gene Names

  • JEM-1

Open Datasheet


Target Information

항목 내용
Target Protein basic leucine zipper nuclear factor 1
Target Gene BLZF1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000002884 (87%), Mouse ENSMUSG00000026577 (85%)

Antigen Sequence:
KSLGHHKGEFLGQSEGVIEPNKELSEVKNVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDLQYHFERLARE


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.