CacheBy
Atlas Antibodies Anti-PCSK1N Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PCSK1N Antibody

상품 한눈에 보기

Human PCSK1N 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 데이터 기반 직교 검증을 거쳤습니다. Human에 반응하며 Mouse, Rat과 89% 동일성 있습니다.

카탈로그번호
HPA064734-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064734-100 Anti-PCSK1N Antibody, proprotein convertase subtilisin/kexin type 1 inhibitor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064734-25 Anti-PCSK1N Antibody, proprotein convertase subtilisin/kexin type 1 inhibitor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PCSK1N Antibody

Anti-PCSK1N Antibody

Proprotein convertase subtilisin/kexin type 1 inhibitor


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human PCSK1N


Alternative Gene Names

  • SAAS

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Proprotein convertase subtilisin/kexin type 1 inhibitor
Target Gene PCSK1N
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000039278 (89%)
  • Rat ENSRNOG00000046021 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.