CacheBy
Atlas Antibodies Anti-PCP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PCP2 Antibody

상품 한눈에 보기

Human PCP2 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구에 적합. Recombinant PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Human에 검증된 반응성을 보유하며, 안정적인 PBS/glycerol 버퍼에 보존됨.

카탈로그번호
HPA057428-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057428-100 Anti-PCP2 Antibody, Purkinje cell protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057428-25 Anti-PCP2 Antibody, Purkinje cell protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PCP2 Antibody

Anti-PCP2 Antibody

Target Information

  • Target Protein: Purkinje cell protein 2
  • Target Gene: PCP2
  • Alternative Gene Names: GPSM4, MGC41903

Product Description

Polyclonal antibody against human PCP2, designed for research use.
Affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000000993): 85%
  • Mouse (ENSMUSG00000004630): 82%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Recommended Applications ICC (Immunocytochemistry)
Storage Notes Gently mix before use. Determine optimal concentrations and conditions experimentally.

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.