CacheBy
Atlas Antibodies Anti-PCDHB14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PCDHB14 Antibody

상품 한눈에 보기

인간 PCDHB14 단백질에 대한 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합합니다. 40% glycerol과 PBS buffer에 보존되어 있습니다.

카탈로그번호
HPA007692-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007692-100 Anti-PCDHB14 Antibody, protocadherin beta 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007692-25 Anti-PCDHB14 Antibody, protocadherin beta 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PCDHB14 Antibody

Anti-PCDHB14 Antibody

Target Information

  • Target Protein: protocadherin beta 14
  • Target Gene: PCDHB14
  • Alternative Gene Names: PCDH-BETA14

Product Description

Polyclonal antibody against human PCDHB14.

  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RKTFEINPISGEVNLRSPLDFEVIQSYTINIQATDGGGLSGKCTLLVKVMDINDNPPEVTISSITKRIPENASETLVALFSILDQDSGDNGRMICSIQDNLP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000046191 (82%)
  • Rat ENSRNOG00000033123 (80%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.