CacheBy
Atlas Antibodies Anti-PCDHA12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PCDHA12 Antibody

상품 한눈에 보기

Human PCDHA12 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 ICC에 적합합니다. Affinity purification 방식으로 제조되었으며, 높은 특이성과 재현성을 제공합니다. 40% glycerol 기반 PBS buffer에 보존 처리되어 있습니다.

카탈로그번호
HPA035812-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035812-100 Anti-PCDHA12 Antibody, protocadherin alpha 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035812-25 Anti-PCDHA12 Antibody, protocadherin alpha 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PCDHA12 Antibody

Anti-PCDHA12 Antibody

Target Information

  • Target Protein: protocadherin alpha 12
  • Target Gene: PCDHA12
  • Alternative Gene Names: PCDH-ALPHA12

Product Description

Polyclonal antibody against human PCDHA12.
Affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVNAIDKGIPSMAGHSMVLVEV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000020119 (50%)
  • Mouse ENSMUSG00000103707 (49%)
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Determine optimal concentration and conditions per application.

References

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.