
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PCCB Antibody
상품 한눈에 보기
Human PCCB 단백질을 타깃으로 하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 확보. RNA-seq 및 독립 항체 비교를 통한 정밀 검증 수행.
- 카탈로그번호
- HPA036940-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036940-100 Anti-PCCB Antibody, propionyl CoA carboxylase, beta polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036940-25 Anti-PCCB Antibody, propionyl CoA carboxylase, beta polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PCCB Antibody
Anti-PCCB Antibody
Target: propionyl CoA carboxylase, beta polypeptide (PCCB)
Type: Polyclonal Antibody against Human PCCB
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison with RNA-seq data in high and low expression tissues.
- WB (Independent validation): Protein expression validated by comparison with independent antibodies targeting different epitopes.
Product Description
- Polyclonal antibody raised in rabbit against Human PCCB
- Validated for IHC and WB applications
- Enhanced validation ensures reliability and reproducibility
- Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | propionyl CoA carboxylase, beta polypeptide |
| Target Gene | PCCB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSV |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000015869 (99%), Mouse ENSMUSG00000032527 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



