Atlas Antibodies Anti-PC Antibody

상품 한눈에 보기

Human pyruvate carboxylase(PC)를 타깃으로 하는 rabbit polyclonal antibody. IHC 및 WB에서 RNA-seq 데이터 기반 orthogonal validation 완료. Affinity purification으로 높은 특이성과 재현성 확보. 다양한 종에서 높은 보존성 확인.

카탈로그번호: HPA043922-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043922-100 Anti-PC Antibody, pyruvate carboxylase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043922-25 Anti-PC Antibody, pyruvate carboxylase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PC Antibody

Anti-PC Antibody

Target: Pyruvate carboxylase (PC)
Type: Polyclonal Antibody against Human PC

Recommended Applications

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human pyruvate carboxylase (PC).

Alternative Gene Names

Target Information

항목	내용
Target Protein	Pyruvate carboxylase
Target Gene	PC
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQ
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000024892 (97%), Rat ENSRNOG00000019372 (97%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand